Sequence of I0Q2E0_STROR

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
tagatose-bisphosphate aldolase
I0Q2E0
Streptococcus oralis SK610
326
36201
Reaction
D-tagatose 1,6-bisphosphate = glycerone phosphate + D-glyceraldehyde 3-phosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>I0Q2E0|tagatose-bisphosphate aldolase|EC 4.1.2.40|Streptococcus oralis SK610|TrEMBL
MVLTENKRACLQKLSDENGIISALAFDQRGALKRLMAQYQTEEPTVAQMEELKVLVADEL
TKYASSMLLDPEYGLPATKALDPNAGLLLAYEKTGYDTTSTKRLPDCLDVWSAKRIKEQG
ADAVKFLLYYDVDSSDELNQEKQAYIERIGSECVAEDIPFFLEILAYDEKIADAGSAEYA
KVKPHKVIGAMKVFSDPRFNIDVLKVEVPVNVKYVEGFGDGKIVHTREEAAAFFKAQDEA
TNLPYIYLSAGVSAKLFQETLVFAHESGANFNGVLCGRATWAGSVEAYIKDGEAAAREWL
RTTGFENIDELNKVLQTTATSWTERV
Download this sequence
in fasta format
Download all sequences for 4.1.2.40
in fasta format
in csv (Excel, OpenOffice) format