Sequence of RNN1_NEUCR

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
ribonuclease T1
P09646
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
153
16012
Reaction
[RNA fragment]-3'-guanosine-2',3'-cyclophosphate + H2O = [RNA fragment]-3'-guanosine-3'-phosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>P09646|ribonuclease T1|EC 4.6.1.24|Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)|Swiss-Prot
MVQLLSAFVSLLSVVAVSGAAIPAPAPEAVVDVAPETATIEPTGNFTAQACMYICGSVCY
SSSAISAALNKGYSYYEDGATAGSSSYPHRYNNYEGFDFPTAKPWYEFPILSSGRVYTGG
SPGADRVIFDSHGNLDMLITHNGASGNNFVACN
Download this sequence
in fasta format
Download all sequences for 4.6.1.24
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
343672
Mannhaupt G.,Montrone C.,Haase D.,Mewes H.-W.,Aign V.,Hoheisel J.D.,Fartmann B.,Nyakatura G.,Kempken F.,Maier J.,Schulte U.
What's in the genome of a filamentous fungus? Analysis of the Neurospora genome sequence.
Nucleic Acids Res.
31
1944-1954
2003
343673
Galagan J.E.,Calvo S.E.,Borkovich K.A.,Selker E.U.,Read N.D.,Jaffe D.B.,FitzHugh W.,Ma L.-J.,Smirnov S.,Purcell S.,Rehman B.,Elkins T.,Engels R.,Wang S.,Nielsen C.B.,Butler J.,Endrizzi M.,Qui D.,Ianakiev P.,Bell-Pedersen D.,Nelson M.A.,Werner-Washburne M.,Selitrennikoff C.P.,Kinsey J.A.,Braun E.L.,Zelter A.,Schulte U.,Kothe G.O.,Jedd G.,Mewes H.-W.,Staben C.,Marcotte E.,Greenberg D.,Roy A.,Foley K.,Naylor J.,Stange-Thomann N.,Barrett R.,Gnerre S.,Kamal M.,Kamvysselis M.,Mauceli E.W.,Bielke C.,Rudd S.,Frishman D.,Krystofova S.,Rasmussen C.,Metzenberg R.L.,Perkins D.D.,Kroken S.,Cogoni C.,Macino G.,Catcheside D.E.A.,Li W.,Pratt R.J.,Osmani S.A.,DeSouza C.P.C.,Glass N.L.,Orbach M.J.,Berglund J.A.,Voelker R.,Yarden O.,Plamann M.,Seiler S.,Dunlap J.C.,Radford A.,Aramayo R.,Natvig D.O.,Alex L.A.,Mannhaupt G.,Ebbole D.J.,Freitag M.,Paulsen I.,Sachs M.S.,Lander E.S.,Nusbaum C.,Birren B.W.
The genome sequence of the filamentous fungus Neurospora crassa.
Nature
422
859-868
2003
343674
Takahashi K.
The amino acid sequence of ribonuclease N1, a guanine-specific ribonuclease from the fungus Neurospora crassa.
J. Biochem.
104
375-382
1988