Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of A0A5S9R2V3_MYCVN

EC Number:1.3.99.38

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
menaquinone-9 beta-reductase
A0A5S9R2V3
Mycolicibacterium vanbaalenii
394
42892
Reaction
menaquinone-9 + reduced acceptor = beta-dihydromenaquinone-9 + acceptor
Other sequences found for EC No. 1.3.99.38

General information:

Sequence
show sequence in normal format
>A0A5S9R2V3|menaquinone-9 beta-reductase|EC 1.3.99.38|Mycolicibacterium vanbaalenii|TrEMBL
MTQRYDLVIAGGGPSGSAAAWQAAQTGAKVVVLDKAQFPRDKPCGDGLTARAVSYLQKMG
LADEVATFHRVNRVTVFSPSEWELSFPKRPGMPDHGHTVSRTHLDTVLLKHAESAGAEVR
QGAEVTGPEMDADGRVIGVTLKGGEKVYGDAVIAADGAYSPIKRALKIDSEYNGYQAIAI
RSEMHANRPDSDSLDIYLKLVFEGDQLPGYGWVFPMGDGIFNIGLGYVNSYKNWQSINAT
QFLGEFLRTLPRDWDLPPIEELKKNKSVRAWRLPMGFTAWPPWRPGVLFTGDSLGAGKPA
SGAGISKALESGLAAGECAIAALQNGGPDDFTNYAQRMEAAWGREYKRGRYMHKLIGQPK
LANAGVKLIDNAAFRDRMLKALYKKAQGPQHKVK
Download this sequence
in fasta format
Download all sequences for 1.3.99.38
in fasta format
in csv (Excel, OpenOffice) format