Sequence of AMNC_PSESP

EC Number:1.2.1.32

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
aminomuconate-semialdehyde dehydrogenase
Q9KWS5
Pseudomonas sp
491
53722
Reaction
2-aminomuconate 6-semialdehyde + NAD+ + H2O = 2-aminomuconate + NADH + H+
Other sequences found for EC No. 1.2.1.32

General information:

Sequence
show sequence in normal format
>|aminomuconate-semialdehyde dehydrogenase|EC 1.2.1.32||
MKQYRNFVDGKWVESSKTFQDVTPIDGSVVAVVHEADRDLVDAAVKAGHRALEGEWGRTT
AAQRVDWLRRIANEMERRQQDFLDAEMADTGKPLSMAATIDIPRGIANFRNFADILATAP
VDSHRLDLPDGAYALNYAARKPLGVVGVISPWNLPLLLLTWKVAPALACGNAVVVKPSED
TPGTATLLAEVMEAVGIPPGVFNLVHGFGPNSAGEFISQHPDISAITFTGESKTGSTIMR
AAAEGVKPVSFELGGKNAAVIFADCDFEKMLDGMMRALFLNSGQVCLCSERVYVERPIFD
RFCVALAERIKALKVDWPHETDTQMGPLISSKHRDKVLSYFELARQEGATFLAGGGVPRF
GDERDNGAWVEPTVIAGLSDDARVVREEIFGPICHVTPFDSESEVIRRANDTRYGLAATI
WTTNLSRAHRVSELMRVGISWVNTWFLRDLRTPFGGAGLSGIGREGGMHSLNFYSELTNV
CVRIDKESPDV
Download this sequence
in fasta format
Download all sequences for 1.2.1.32
in fasta format
in csv (Excel, OpenOffice) format