Sequence of S2FIY1_9PSED

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
long-chain acyl-CoA dehydrogenase
S2FIY1
Pseudomonas sp. G5(2012)
815
89001
Reaction
a long-chain acyl-CoA + electron-transfer flavoprotein = a long-chain trans-2,3-dehydroacyl-CoA + reduced electron-transfer flavoprotein
Sequences with same EC No.
Sequence
show sequence in normal format
>S2FIY1|long-chain acyl-CoA dehydrogenase|EC 1.3.8.8|Pseudomonas sp. G5(2012)|TrEMBL
MLLLWIMVLVVGIAYLAHRRIAPLPALGIVAVFLLAMGAFSRAPGWLLLIFWVLTAAVAA
PLLLPDLRRKFFSAPMFNWFQKTLPPMSDTERDAIEAGTVWWDGELFSGRPDWNKLLSYP
KVQLNEEEQTFIDGPTEELCAMVSDWQLGQTMDLPAEAWTYIKDNGFFALIIPKEFGGKG
FSAYAHSQVAMKLASHSGDLASTVMVPNSLGPAELLLHYGTDEQRNHYLPRLARGDEIPC
FALTGPLAGSDAGGMPDTGVICKGEWEGKETLGLRLNWEKRYITLGPVATLLGLAFKAYD
PDHLLGEEEDLGISLALIPTDLPGVEIGRRHLPLGAAFMNGPNSGKDVFVPLEFLIGGQE
MLGKGWMMLMNCLSVGRSISLPAVGTGMAKFTSLVTGQYAQIREQFNVPIAAFEGIQEAM
ARIGGNAWMMDAARMLTANAVDLGEKPSVLSAILKYHLTERGRECISQAMDVHGGKAIIM
GPNNYLGRKWNGAPIFITVEGANILSRNLMIFGQGAIRCHPFVLKEMALATREDKDQALT
EFDGLLLKHIGFAVGNAASTLVLNLGFGHLEHVPGDKLSQGYFRALNRQAAAFALLADLS
MMLLGGELKRRERLSARLGDVLSNLYLASAALKRYNDLDSPEYMKPLFTWAMEESLGHGE
RAMDELLNNFPSKGLACLLRVIVFPFGRRHKGPSDKLGAEVAAVIGRAKGDPALEEVLLG
CYRPQSVEDPVGVLQHTCDQLNAALPMRKKLHMALKSGQVKPVAGENVIDAALEAGVLQP
VEAHTLREAEVARRKVIDVDAFDKEEIALTDGKVR
Download this sequence
in fasta format
Download all sequences for 1.3.8.8
in fasta format
in csv (Excel, OpenOffice) format