Sequence of A0A083ZRW4_RHIRD

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
L-idonate 5-dehydrogenase
A0A083ZRW4
Rhizobium radiobacter
347
36674
Reaction
L-idonate + NAD(P)+ = 5-dehydro-D-gluconate + NAD(P)H + H+
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A083ZRW4|L-idonate 5-dehydrogenase|EC 1.1.1.264|Rhizobium radiobacter|TrEMBL
MRGVVIHAAKDLRVEDVAGQPLAADEVRVAVAVGGICGSDLHYYNHGGFGTVRVREPMAL
GHEFAGTVVEVGSSVSHLVPGMRVAVNPSLPCGTCRYCAQGRQNQCLDMRFMGSAMRSPH
VQGGFREVVTVHSTQPVQIADGLSMGEAAMAEPLAVCLHAARQAGSLLGKTVLITGAGPI
GMLSLLVARLAGAAHIVVTDVADAPLDLARRIGADEAVNILRDADMLEKYRFEKGVFDVL
FEASGNQAALLPALDLLRPGGIIVQLGLGGDFTIPMNLIVAKELQLRGTFRFHEEFAQAV
NMMGRGLIDVKPLISATLPFDQAREAFDLAGDRAKSMKVQLAFSGAA
Download this sequence
in fasta format
Download all sequences for 1.1.1.264
in fasta format
in csv (Excel, OpenOffice) format