Sequence of A0A343TMH0_9EURY

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
coproporphyrinogen III oxidase (coproporphyrin-forming)
A0A343TMH0
Halalkaliarchaeum desulfuricum
427
46673
Reaction
coproporphyrinogen III + 3 O2 = coproporphyrin III + 3 H2O2
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A343TMH0|coproporphyrinogen III oxidase (coproporphyrin-forming)|EC 1.3.3.15|Halalkaliarchaeum desulfuricum|TrEMBL
MTVGVVGAGVSGLAVVRELSNRGVDVVGFEARKEPGGIMRSRQVDGHVLELGPQRLRLTE
QMSGLIDELGLREELRIGDDDQPMYVYLDGELKVVPLSVREAFTTDLLSIGGKVRILKEP
FTEPPRDGETVEEFLTRKFGRQAARRYLGPLYSGLYGTDPDEMLMEYSLGKALRGAGIDG
SILLWLIRKLIGGREVPEICTFEDGLGTLSDALYEANADSIRLETPVTEIRRDGDGFEIA
TAGGVTSVDEVVITTQADSAAELLSGVDDGTAETLERFNYNPIAMVYLESAFDRPGIGTL
VPWYESSKISGTTWNSSFLHRDGLFTCYVDPGSYPEMLEVSEETLGEEIAREFETLTGSP
ATPIDVHLIEPGMPAYDRSWKALDELTPPDGIHFCTAFTERPGIPGRLRHAARVAGQITE
SESGFGR
Download this sequence
in fasta format
Download all sequences for 1.3.3.15
in fasta format
in csv (Excel, OpenOffice) format