Sequence of A0A0S3IUL8_9EUGL

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
A0A0S3IUL8
Entosiphon sp. TCS 2003
352
38074
Reaction
D-glyceraldehyde 3-phosphate + phosphate + NAD+ = 3-phospho-D-glyceroyl phosphate + NADH + H+
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A0S3IUL8|glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)|EC 1.2.1.12|Entosiphon sp. TCS 2003|TrEMBL
MVKVGINGFGRIGRMVFQALCDQGLLGEIDVVAVVDVTTDADYFAYQMKYDSIHGKFKHA
VTTEKSHEGAQENDVLVVNGHKIKCVQATRSPAELPWAALGVEIVIESTGLFTESEKAQG
HITAGAKKVIISAPAKGEVKTLVVGVNHEEYDAKTHNIVSNASCTTNCLAPLVHVLLKEG
VGIEKGLMTTIHSYTATQKTVDGPSKKDWRGGRAAAINIIPSTTGAAKAVGEVLPAVNGK
LTGMAFRVPTPDVSVVDLTFTAERDTSIAEIDALFKKASETYLKGILGVTSEELVSTDFI
HDNRSSIYDSLATLQNNLKGEKRFFKVVSWYDNEWGYSNRVVDLLKHMISHA
Download this sequence
in fasta format
Download all sequences for 1.2.1.12
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
79412745
Markunas C.M.,Triemer R.E.
Evolutionary History of the Enzymes Involved in the Calvin-Benson Cycle in Euglenids.
J. Eukaryot. Microbiol.
0
0-0
2015