Any feedback?
Please rate this page
(all_enzymes.php)
(0/150)

BRENDA support

2.1.1.244: protein N-terminal methyltransferase

This is an abbreviated version!
For detailed information about protein N-terminal methyltransferase, go to the full flat file.

Word Map on EC 2.1.1.244

Reaction

2 S-adenosyl-L-methionine +

N-terminal-PPK-[protein]
= 2 S-adenosyl-L-homocysteine +
N-terminal-N,N-dimethyl-N-PPK-[protein]

Synonyms

alpha-N-methyltransferase, alpha-N-terminal methyltransferase 1, alphaN-methyltransferase, CG1675, dNTMT, EEF1A lysine methyltransferase 1, eEF1A-KMT1, EEF1AKMT1, Efm5, Efm7, elongation factor methyltransferase 7, FEAT, METT11B, METTL11A, METTL11a/C9orf32/Ad-003, METTL13, METTL13/FEAT, N-terminal and lysine methyltransferase, N-terminal methyltransferase, N-terminal methyltransferase 1, N-terminal RCC1 methyltransferase, N-terminal RCC1 methyltransferase 1, N-terminal Xaa-Pro-Lys N-methyltransferase 1, N6AMT2, NMT1, NNT1, NRMT, NRMT1, Ntm1, NTMT1, peptide N-terminal methyltransferase, PrmA, protein methyltransferase, protein N-terminal methyltransferase 1, Rkm2, SS alphaN-methyltransferase, SSMT, TAE1, YBR261C, YBR261C/Tae1, YGR001C, YLR285W

ECTree

     2 Transferases
         2.1 Transferring one-carbon groups
             2.1.1 Methyltransferases
                2.1.1.244 protein N-terminal methyltransferase

Cloned

Cloned on EC 2.1.1.244 - protein N-terminal methyltransferase

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
CLONED (Commentary)
ORGANISM
UNIPROT
LITERATURE
gene EEF1AKMT1, sequence comparisons, recombinant expression of N-terminally His6-tagged enzyme in Escherichia coli strain Rosetta DE3
gene EFM5, sequence comparisons, recombinant expression of N-terminally His6-tagged enzyme in Escherichia coli strain Rosetta DE3
gene EFM7, sequence comparisons, recombinant expression of N-terminally His6-tagged enzyme in Escherichia coli strain Rosetta DE3
gene METTL11A
-
gene METTL11A, cloning of the His-tagged human enzyme using vector pET-100/DTOPO that carries a His6 tag in the linker region MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDHPFT, which is incorporated before the initiator methionine residue of the cloned protein, and expression in Escherichia coli strain BL21(DE3)
gene NTMT1, recombinant expression of His-tagged NRMT1 in Escherichia coli and of FLAG-tagged wild-type and mutant NRMT1s in HEK-293 cells, recombinant expression of GFP-tagged enzyme in HCT-116 cells
generbcMTS, DNA and amino acid sequence determination and analysis, expression of a N-terminal truncated form of spinach SSMT in Escherichia coli
-
N-terminally tagged FLAG-NRMT overexpression in HEK 293LT cell nuceli, that show 3fold increased RCC1 alpha-N-methyltransferase activity
-
recombinant expression of His-tagged enzyme in Escherichia coli strain BL21-CodonPlus(DE3)-RIL
recombinant expression of His-tagged wild-type and mutant enzymes in Escherichia coli
recombinant expression of N-terminally His6-tagged wild-type and mutant enzymes NTMT1 with a thrombin cleavage site at the N-terminus in Escherichia coli strain BL21(DE3) codon plus RIL
-