Sequence of PDXB_ALIF1

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
4-phosphoerythronate dehydrogenase
Q5E452
Aliivibrio fischeri (strain ATCC 700601 / ES114)
376
41844
Reaction
4-phospho-D-erythronate + NAD+ = (3R)-3-hydroxy-2-oxo-4-phosphooxybutanoate + NADH + H+
Sequences with same EC No.
Sequence
show sequence in normal format
>Q5E452|4-phosphoerythronate dehydrogenase|EC 1.1.1.290|Aliivibrio fischeri (strain ATCC 700601 / ES114)|Swiss-Prot
MKILIDENMPYAAELFSGLGEVIAKSGRTLTADDLIDVDALMIRSVTKVNAELIEKANKL
KFVGTATAGMDHVDQALLKEKGIFFTAAPGCNKVGVAEYVLSCLMVLAQQHGFSIFDKTF
GIVGAGQVGSYLAQCLDALNISYLLNDPIKEQEGDSRSFVALDELLEKSDVITLHTPITR
DGEYPTHHLIGQKTLSKLRNDQILINAARGPVVDNQALKQRLLKQDGFKAVLDVFEFEPD
VDMELLPLLSFATPHIAGYGLEGKARGTTMIFNFYCEFLKRNERADPQTLLPIAPIPNVT
LNQQWDHSTLHNLIQLVYDVRKDDAVFRKEIATVGAFDKMRKDYWDRREYSAITITGTQC
CDLTPLQQLGFTIEEV
Download this sequence
in fasta format
Download all sequences for 1.1.1.290
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
807534
Ruby E.G.,Urbanowski M.,Campbell J.,Dunn A.,Faini M.,Gunsalus R.,Lostroh P.,Lupp C.,McCann J.,Millikan D.,Schaefer A.,Stabb E.,Stevens A.,Visick K.,Whistler C.,Greenberg E.P.
Complete genome sequence of Vibrio fischeri: a symbiotic bacterium with pathogenic congeners.
Proc. Natl. Acad. Sci. U.S.A.
102
3004-3009
2005