Sequence of NUDC_PSEPW

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
NAD+ diphosphatase
B1J6H6
Pseudomonas putida (strain W619)
276
30963
Reaction
NAD(H) + H2O = AMP + NMN(H)
Sequences with same EC No.
Sequence
show sequence in normal format
>B1J6H6|NAD+ diphosphatase|EC 3.6.1.22|Pseudomonas putida (strain W619)|Swiss-Prot
MSARWTSAVLDPQITGGWAVARSPEGFLVDANGALFPRDWLKRQDLDVLAEHGIGHFDGE
PVFLLELRSTAEVPGCGWRGLRSFMLEGDFDLYKVLGYAAQIGTWAREHRFCGSCGQPMT
QIRWERAMYCQPCDLRSYPRISPSMIVLVTRGDEILLARSPRFVTGVYSTLAGFAEPGES
AEDCLVREVREEVAVEVTNIQYVGSQCWPFPHSMMLGFHAEYAGGEIVMQPDEIEDARWF
NVHDLPPLPAGRSIARYLIDLYVARRSGLPEPVLPR
Download this sequence
in fasta format
Download all sequences for 3.6.1.22
in fasta format
in csv (Excel, OpenOffice) format