Sequence of RIMJ_PSEAE

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
[ribosomal protein S5]-alanine N-acetyltransferase
Q9I2H6
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
189
21365
Reaction
acetyl-CoA + an N-terminal L-alanyl-[S5 protein of 30S ribosome] = CoA + an N-terminal N-acetyl-L-alanyl-[S5 protein of 30S ribosome]
Sequences with same EC No.
Sequence
show sequence in normal format
>Q9I2H6|[ribosomal protein S5]-alanine N-acetyltransferase|EC 2.3.1.267|Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)|Swiss-Prot
MPGNRRQVPILHRDADFLLRALQPDDFVRTSRYENANREHLAPWEPLRDPGYFSVDNARA
RTLLQVASMDEGEALLLLLLDPDDGEVLGRCSYTNIVRGVFQACHLGFSLAAAAQGRGLM
ARALRVANRYCFEQLGLHRIMASHLPRNARSERLLESLGFEKEGYARAYLKIAGVWEDHV
LRALVDAPR
Download this sequence
in fasta format
Download all sequences for 2.3.1.267
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
85839
Stover C.K.,Pham X.-Q.T.,Erwin A.L.,Mizoguchi S.D.,Warrener P.,Hickey M.J.,Brinkman F.S.L.,Hufnagle W.O.,Kowalik D.J.,Lagrou M.,Garber R.L.,Goltry L.,Tolentino E.,Westbrock-Wadman S.,Yuan Y.,Brody L.L.,Coulter S.N.,Folger K.R.,Kas A.,Larbig K.,Lim R.M.,Smith K.A.,Spencer D.H.,Wong G.K.-S.,Wu Z.,Paulsen I.T.,Reizer J.,Saier M.H. Jr.,Hancock R.E.W.,Lory S.,Olson M.V.
Complete genome sequence of Pseudomonas aeruginosa PAO1, an opportunistic pathogen.
Nature
406
959-964
2000