Sequence of A0A330QYA2_KLEPN

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
benzoate 1,2-dioxygenase
A0A330QYA2
Klebsiella pneumoniae
161
19341
Reaction
benzoate + NADH + H+ + O2 = (1R,6S)-1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate + NAD+
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A330QYA2|benzoate 1,2-dioxygenase|EC 1.14.12.10|Klebsiella pneumoniae|TrEMBL
MLNLEQVRQFLYYEARLLDDRQWDEWLSCYSPQVVYWMPAWGDDDQLTRDPQKEISLIYY
PNREGLEDRVYRIKTERSGASTPEPRTTHIISNVELLGESDEGLEVRYNWVTWSHRYQHT
DAYFGSTCCTLIEQDGRPQIVRKTVRLNNDYIRQVIDVYHI
Download this sequence
in fasta format
Download all sequences for 1.14.12.10
in fasta format
in csv (Excel, OpenOffice) format