Sequence of MBOA5_BOVIN

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
1-acylglycerophosphocholine O-acyltransferase
Q3SZL3
Bos taurus
485
55834
Reaction
acyl-CoA + 1-acyl-sn-glycero-3-phosphocholine = CoA + 1,2-diacyl-sn-glycero-3-phosphocholine
Sequences with same EC No.
Sequence
show sequence in normal format
>Q3SZL3|1-acylglycerophosphocholine O-acyltransferase|EC 2.3.1.23|Bos taurus|Swiss-Prot
MASAAEGDMEAELTRGLLWGFQDLSLNKLATSLGASEQALRLIISIFLGYPFALFYRRYL
FYKDSYLIHLFHTFTGLSIAYYNFGTQLYHSLLCIVLQFLILRLMGRTITAVLTTFCVQM
GYLLAGYYNTATGTYDIKWTMPHCVLTLKLIGLAMDYYDGGKDQKSLTSEQQIYAIWGVP
SLLEISGFSYFYGAFLVGPQFSMNHYMKLVRGELTDVPGKIPNSTIPALRRLALGLVYLV
GYTLLSPHITEDYLLSDDYENGSFWFRCMYMLIWGKFVLYKYVTCWLVTEGVCILTGLGF
NGLDEYGTAKWDACANMKVWLFETTPRFTGTIASFNINTNAWVARYFFKRLKFLGNKVLS
QGLSLLFLALWHGLHSGYLVCFQMEFLIVIVERQAASLIRDSPVLSRLASITVLQPLYYL
AQQTIHWLFMGYSMTAFCLFTWDKWMKVYKSIYFLGHVFFLSLLFILPYVRKVMVPRKEK
LKKME
Download this sequence
in fasta format
Download all sequences for 2.3.1.23
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
179222
Harhay G.P.,Sonstegard T.S.,Keele J.W.,Heaton M.P.,Clawson M.L.,Snelling W.M.,Wiedmann R.T.,Van Tassell C.P.,Smith T.P.L.
Characterization of 954 bovine full-CDS cDNA sequences.
BMC Genomics
6
166-166
2005