Sequence of NCPR_ASPFU

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
NADPH-hemoprotein reductase
Q4WM67
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100)
695
76783
Reaction
NADPH + H+ + n oxidized hemoprotein = NADP+ + n reduced hemoprotein
Sequences with same EC No.
Sequence
show sequence in normal format
>Q4WM67|NADPH-hemoprotein reductase|EC 1.6.2.4|Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100)|Swiss-Prot
MAQLDTLDIVVLVVLLVGSVAYFTKGSYWAVPKDPYAAANSAMNGAAKTGKTRDIIQKME
ETGKNCVIFYGSQTGTAEDYASRLAKEGSQRFGLKTMVADLEDYDYENLDKFPEDKIAFF
VLATYGEGEPTDNAVEFYQFITGEDVAFESGASAEEKPLSSLKYVAFGLGNNTYEHYNAM
VRHVDAALTKLGAQRIGTAGEGDDGAGTMEEDFLAWKEPMWAALSESMNLQEREAVYEPV
FSVIEDESLSPEDDSVYLGEPTQGHLSGSPKGPYSAHNPYIAPIVESRELFTAKDRNCLH
MEIGIAGSNLTYQTGDHIAIWPTNAGVEVDRFLEVFGIEKKRHTVINIKGLDVTAKVPIP
TPTTYDAAVRFYMEICAPVSRQFVSSLVPFAPDEESKAEIVRLGNDKDYFHEKISNQCFN
IAQALQNITSKPFSAVPFSLLIEGLNRLQPRYYSISSSSLVQKDKISITAVVESVRLPGA
SHIVKGVTTNYLLALKQKQNGDPSPDPHGLTYAITGPRNKYDGIHVPVHVRHSNFKLPSD
PSKPIIMVGPGTGVAPFRGFIQERAALAESGKDVGPTILFFGCRNRNEDFLYKEEWKVYQ
EKLGDKLKIITAFSRETAKKVYVQHRLQEHADLVSDLLKQKATFYVCGDAANMAREVNLV
LGQIIAKSRGLPAEKGEEMVKHMRSSGSYQEDVWS
Download this sequence
in fasta format
Download all sequences for 1.6.2.4
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
183362
Nierman W.C.,Pain A.,Anderson M.J.,Wortman J.R.,Kim H.S.,Arroyo J.,Berriman M.,Abe K.,Archer D.B.,Bermejo C.,Bennett J.W.,Bowyer P.,Chen D.,Collins M.,Coulsen R.,Davies R.,Dyer P.S.,Farman M.L.,Fedorova N.,Fedorova N.D.,Feldblyum T.V.,Fischer R.,Fosker N.,Fraser A.,Garcia J.L.,Garcia M.J.,Goble A.,Goldman G.H.,Gomi K.,Griffith-Jones S.,Gwilliam R.,Haas B.J.,Haas H.,Harris D.E.,Horiuchi H.,Huang J.,Humphray S.,Jimenez J.,Keller N.,Khouri H.,Kitamoto K.,Kobayashi T.,Konzack S.,Kulkarni R.,Kumagai T.,Lafton A.,Latge J.-P.,Li W.,Lord A.,Lu C.,Majoros W.H.,May G.S.,Miller B.L.,Mohamoud Y.,Molina M.,Monod M.,Mouyna I.,Mulligan S.,Murphy L.D.,O'Neil S.,Paulsen I.,Penalva M.A.,Pertea M.,Price C.,Pritchard B.L.,Quail M.A.,Rabbinowitsch E.,Rawlins N.,Rajandream M.A.,Reichard U.,Renauld H.,Robson G.D.,Rodriguez de Cordoba S.,Rodriguez-Pena J.M.,Ronning C.M.,Rutter S.,Salzberg S.L.,Sanchez M.,Sanchez-Ferrero J.C.,Saunders D.,Seeger K.,Squares R.,Squares S.,Takeuchi M.,Tekaia F.,Turner G.,Vazquez de Aldana C.R.,Weidman J.,White O.,Woodward J.R.,Yu J.-H.,Fraser C.M.,Galagan J.E.,Asai K.,Machida M.,Hall N.,Barrell B.G.,Denning D.W.
Genomic sequence of the pathogenic and allergenic filamentous fungus Aspergillus fumigatus.
Nature
438
1151-1156
2005
183363
Baillie G.S.,Hitchcock C.A.,Burnet F.R.
Increased cytochrome P-450 activity in Aspergillus fumigatus after xenobiotic exposure.
J. Med. Vet. Mycol.
34
341-347
1996