Sequence of D5P3L7_9MYCO

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
alpha-methylacyl-CoA racemase
D5P3L7
Mycobacterium parascrofulaceum ATCC BAA-614
419
44749
Reaction
(2S)-2-methylacyl-CoA = (2R)-2-methylacyl-CoA
Sequences with same EC No.
Sequence
show sequence in normal format
>D5P3L7|alpha-methylacyl-CoA racemase|EC 5.1.99.4|Mycobacterium parascrofulaceum ATCC BAA-614|TrEMBL
MAVRPRELAMSGVRGRVLQGVRVVELASWTYVPSAGAALSDWGADVIKVEGVAAGDPGRA
LVVGGFTRQAARPDADFILELGNRGKRSIAIDIKSEAGRELFGRLLANADVFLTNWLPGA
LERARLTVADVRSFNPKIIIARGTGLGVRGPDRDRGGFDAATYLARGGVAYTLTPFGSET
PAVQGPGFGDLQGGATLAGGVCAALFHRERTGEPTIVDSSLLAQAMWAIAPSISAADFFD
IDGIPGAPPGLAINPLVNRYKTRDGRWIQLVFLQPDKFWAGFCERVGLAELATDERFVPS
TNLIANAAAATEILADVFARHDLAHWQKALEDEPGVWGALATPRETLNDPQVEPNGYVIT
NVDDHGEKYRIVAAPVQFDETPPAPARAPEHGQHTEEILLELGVDWDGIARAKDARAIL
Download this sequence
in fasta format
Download all sequences for 5.1.99.4
in fasta format
in csv (Excel, OpenOffice) format