Sequence of A0A381IZM4_CLOPF

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
clostripain
A0A381IZM4
Clostridium perfringens
522
59103
Reaction
Preferential cleavage: Arg-/-, including Arg-/-Pro, but not Lys-
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A381IZM4|clostripain|EC 3.4.22.8|Clostridium perfringens|TrEMBL
MFKKKLSLLMATITIGSVLLGGASTVSAAPRHKHKTVSEKIKEAEKTQGDKKLTVMVYAD
CDNNLEEYILNDIEEMKEGYKNNPNLNIIVLVDRIPGYSNDSKVLGSNFEDTRLYKIGEN
SAERISGKSEFPEITTTSNYEANMGDANTLKKFIKFCKNNYEADKYMLIMSNHGGGAKDD
KDRASTVNKAICWDDSNNKDCLYTGEISDVLTKDESVDVLVFDACLMGTSEVAYQYRPNN
GSFEAKTLVASAPVVWGNGYPYDKIFSRLRSTKGDNGEVDSTLGGKEKIFDPSTVTNNEL
GALFVEEQRDSVNSYGASSQQLSCYNLSKIETVKKSVDALARNLSKNNKKDVIENLRGTG
KNAPTMHYFKNYDEYEWIEYPYFDLYDLCEKISLSNEFDETTKKLSKNVMKNVDQLILYS
FAGNDFKGFKEGKNGISIFLPDGNRNYYDQYSGQVIPHWAIQRWYNPLDTNAYRLRSGYG
KLAWCKDGLDPKINKVGNWFELLDSWFDKDNTSLGGYNRYRY
Download this sequence
in fasta format
Download all sequences for 3.4.22.8
in fasta format
in csv (Excel, OpenOffice) format