Sequence of A0A1H0YD18_9RHOB

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
ABC-type D-ribose transporter
A0A1H0YD18
Pseudovibrio sp. Tun.PSC04-5.I4
530
57209
Reaction
ATP + H2O + D-ribose-[ribose-binding protein][side 1] = ADP + phosphate + D-ribose[side 2] + [ribose-binding protein][side 1]
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A1H0YD18|ABC-type D-ribose transporter|EC 7.5.2.7|Pseudovibrio sp. Tun.PSC04-5.I4|TrEMBL
MSINKDVGAPSANSGLQAAIGEVRSNASTDNRGQADCVLEMRGISKTFPGVKALDDVSLK
LYPGSVTALIGENGAGKSTLVKILTGVYQSDEGQILLNNEPIKFIDALDATRVGVTAIHQ
ETVLFDELSVAENIFLGQEPRTKLGLIDWGCMEANAAKVLQKLGTQMSPRTILKDLTIGH
KHMVAIARALSTDARIVIMDEPTAALSNKEAEELYDIVDWLKSEGKAILFISHKFEDVFR
IADRYTVFRDGQLVGAGMLADVERADLVKKMVGRSVDRAFPKNNRPGTEVVLKVENYCHP
TEFDSIDFELKRGEILGVYGLVGAGRTEVAQSLFGATHPSHGKLHIEGQEITIRSPDQAI
AAGLVYVPEDRGKQGVTLEMSIAENIGMSSLKATSKQGFLDLAHEYDVARKYADRLDLRA
SALNQSVGSLSGGNQQKVVIGKWLATLPKVIILDEPTKGIDIGSKAAVHSFMSELAEEGL
SVLMISSEIPEVLGMSDRVLVMREGLIVGEFDQADATPEKLVNLATGNIN
Download this sequence
in fasta format
Download all sequences for 7.5.2.7
in fasta format
in csv (Excel, OpenOffice) format