Sequence of G7J763_MEDTR

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
theobromine synthase
G7J763
Medicago truncatula
369
41858
Reaction
S-adenosyl-L-methionine + 7-methylxanthine = S-adenosyl-L-homocysteine + 3,7-dimethylxanthine
Sequences with same EC No.
Sequence
show sequence in normal format
>G7J763|theobromine synthase|EC 2.1.1.159|Medicago truncatula|TrEMBL
MAVEQVLHMNGGEGDTSYANNSTFQRMVMLTAKHILEESIMRLYCDTFPNCLKVADLGCS
SGPNALLVASNIINTIDAVSQKLSHESPMFQFFLNDLFGNDFNTTFKLLPDFIKRLQEEK
GQKFSPCFFSGTPGSFYGRLFPDNSIHFFHSSYSLHWLSKTPDALQDAAIEPLNKGNIYL
TRASPPAVQKTYFEQFQQDFSLFLRSRSSELLPSGAMVLTLIGRDEQNELMNAWVVIGMA
LNDMAAVKLVEQSKLDSFNIPSYCPTSDEIRKVIEEEGSFDVQRLETIRTDWVKNVDVID
DEYTVVDEETRAEGVAKFIRAVAEPILKSEFGEEIMDELFIRFKNKIIKLYGVEKLEVAN
LVMHITKRT
Download this sequence
in fasta format
Download all sequences for 2.1.1.159
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
59885460
Young N.D.,Debelle F.,Oldroyd G.E.D.,Geurts R.,Cannon S.B.,Udvardi M.K.,Benedito V.A.,Mayer K.F.X.,Gouzy J.,Schoof H.,Van de Peer Y.,Proost S.,Cook D.R.,Meyers B.C.,Spannagl M.,Cheung F.,De Mita S.,Krishnakumar V.,Gundlach H.,Zhou S.,Mudge J.,Bharti A.K.,Murray J.D.,Naoumkina M.A.,Rosen B.,Silverstein K.A.T.,Tang H.,Rombauts S.,Zhao P.X.,Zhou P.,Barbe V.,Bardou P.,Bechner M.,Bellec A.,Berger A.,Berges H.,Bidwell S.,Bisseling T.,Choisne N.,Couloux A.,Denny R.,Deshpande S.,Dai X.,Doyle J.J.,Dudez A.-M.,Farmer A.D.,Fouteau S.,Franken C.,Gibelin C.,Gish J.,Goldstein S.,Gonzalez A.J.,Green P.J.,Hallab A.,Hartog M.,Hua A.,Humphray S.J.,Jeong D.-H.,Jing Y.,Jocker A.,Kenton S.M.,Kim D.-J.,Klee K.,Lai H.,Lang C.,Lin S.,Macmil S.L.,Magdelenat G.,Matthews L.,McCorrison J.,Monaghan E.L.,Mun J.-H.,Najar F.Z.,Nicholson C.,Noirot C.,O'Bleness M.,Paule C.R.,Poulain J.,Prion F.,Qin B.,Qu C.,Retzel E.F.,Riddle C.,Sallet E.,Samain S.,Samson N.,Sanders I.,Saurat O.,Scarpelli C.,Schiex T.,Segurens B.,Severin A.J.,Sherrier D.J.,Shi R.,Sims S.,Singer S.R.,Sinharoy S.,Sterck L.,Viollet A.,Wang B.-B.,Wang K.,Wang M.,Wang X.,Warfsmann J.,Weissenbach J.,White D.D.,White J.D.,Wiley G.B.,Wincker P.,Xing Y.,Yang L.,Yao Z.,Ying F.,Zhai J.,Zhou L.,Zuber A.,Denarie J.,Dixon R.A.,May G.D.,Schwartz D.C.,Rogers J.,Quetier F.,Town C.D.,Roe B.A.
The Medicago genome provides insight into the evolution of rhizobial symbioses.
Nature
480
520-524
2011
59885461
Tang H.,Krishnakumar V.,Bidwell S.,Rosen B.,Chan A.,Zhou S.,Gentzbittel L.,Childs K.L.,Yandell M.,Gundlach H.,Mayer K.F.,Schwartz D.C.,Town C.D.
An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
BMC Genomics
15
312-312
2014