Sequence of A0A351CSF4_9MICC

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
acetaldehyde dehydrogenase (acetylating)
A0A351CSF4
Micrococcaceae bacterium
262
27495
Reaction
acetaldehyde + CoA + NAD+ = acetyl-CoA + NADH + H+
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A351CSF4|acetaldehyde dehydrogenase (acetylating)|EC 1.2.1.10|Micrococcaceae bacterium|TrEMBL
LGITTSAEGVDWLLAQDELPDFVFECTSAKAHEANAPKYKAAGIHAIDLTPAAVGPYLAP
VVNLDSLTDTMNVNMITCAGQATTPIVAAVSSVVPVEYAEIVASIASKSAGPGTRANVDE
FTETTAKALEVVGGAKRGKAIIIINPVEPPMMMRNTIYAMIPAEAAAAGQTQDKIRAAID
KAAADIRDYVPGYELRMEPQFEEAREDWGGFGRVGIWVQVAGAADYLPEYAGNLDIITAA
ATRTADLLSEKIDAARSAASVN
Download this sequence
in fasta format
Download all sequences for 1.2.1.10
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
7038261
Parks D.H.,Chuvochina M.,Waite D.W.,Rinke C.,Skarshewski A.,Chaumeil P.A.,Hugenholtz P.
A standardized bacterial taxonomy based on genome phylogeny substantially revises the tree of life.
Nat. Biotechnol.
36
996-1004
2018